PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g21970.2.p
Common NameBRADI_5g21970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 317aa    MW: 34389.9 Da    PI: 6.6999
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g21970.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.7e-151562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEd +l + ++ +G g+W+ +++  g+ R++k+c++rw +yl
  Bradi5g21970.2.p 15 RGLWSPEEDMKLRNHIATFGHGCWSHVPKLAGLERCGKSCRLRWINYL 62
                      788*******************************************97 PP

2Myb_DNA-binding42.51.5e-1370112347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       + ++eE +l+++++  lG++ W+ Ia++++ gRt++++k++w ++
  Bradi5g21970.2.p  70 ALSQEEKDLILNLHSVLGNR-WSQIAARLP-GRTDNEVKNFWSSF 112
                       569*****************.*********.***********765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.121062IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-221064IPR009057Homeodomain-like
SuperFamilySSF466893.29E-2812109IPR009057Homeodomain-like
SMARTSM007173.2E-121464IPR001005SANT/Myb domain
PfamPF002491.4E-131562IPR001005SANT/Myb domain
CDDcd001675.13E-111862No hitNo description
PROSITE profilePS5129422.31863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2065116IPR009057Homeodomain-like
SMARTSM007173.9E-1267115IPR001005SANT/Myb domain
PfamPF002491.3E-1170110IPR001005SANT/Myb domain
CDDcd001671.02E-972109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MPKQLRVPSR KRLRRGLWSP EEDMKLRNHI ATFGHGCWSH VPKLAGLERC GKSCRLRWIN  60
YLRPDLKRVA LSQEEKDLIL NLHSVLGNRW SQIAARLPGR TDNEVKNFWS SFVKKQQPLR  120
HHGAIVEGNP VIVSTGTTVL FSETGHILSS MGVQHNDDMA APLLDPVLVQ IEAESYMYIQ  180
TISMDDVSES VTVTPVRGCS DVTLATSGHM YNGTTEISAG YLDTHGSSGT GHSLVSISSM  240
MASMAGLGAG GSSGPAATDT QHLPWLEDLP GLTGAFTASA ASELADGHYG AAAALDELKW  300
SNDQCMLDAG YQQMQY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25131165107B-MYB
1h8a_C9e-251311625127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.12e-71PREDICTED: myb-related protein Zm1-like
TrEMBLA0A0Q3EDV50.0A0A0Q3EDV5_BRADI; Uncharacterized protein
STRINGBRADI5G21970.11e-123(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.19e-59myb domain protein 50